PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.13G144400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family SBP
Protein Properties Length: 204aa    MW: 22092.1 Da    PI: 9.5768
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.13G144400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.92.2e-4180157178
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          +Cq++ C adls+ak yhrrhkvCe h+ka+ vlv+g++qrfCqqCsrfhelsefDe+k+sCrrrLa+hnerrrk++a
  Manes.13G144400.1.p  80 CCQADMCMADLSDAKPYHRRHKVCENHAKAQIVLVAGIRQRFCQQCSRFHELSEFDETKKSCRRRLAGHNERRRKNAA 157
                          6**************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.3E-3275142IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.56478155IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.84E-3779159IPR004333Transcription factor, SBP-box
PfamPF031104.4E-3281154IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MDGKGKQRMM GKVVKKEAAE LVWESSDDDG YVKMGCVEND VESNKKKKVV AGGCGGGGGG  60
GGGKKGSGGG GCGGSGGMRC CQADMCMADL SDAKPYHRRH KVCENHAKAQ IVLVAGIRQR  120
FCQQCSRFHE LSEFDETKKS CRRRLAGHNE RRRKNAAESH SEGGNHKGTV TQLKDMICGQ  180
VDDRGRIKIT IQENATYKHF QIR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-3871154184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16169GGKKGSGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00634PBMTransfer from PK22320.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002517882.11e-87PREDICTED: squamosa promoter-binding protein 1
SwissprotQ9S7A97e-44SPL4_ARATH; Squamosa promoter-binding-like protein 4
TrEMBLB9RVW31e-87B9RVW3_RICCO; Squamosa promoter-binding protein, putative
STRINGVIT_12s0028g03350.t011e-73(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53534153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.22e-44squamosa promoter binding protein-like 4